Lineage for d1ibks_ (1ibk S:)

  1. Root: SCOP 1.59
  2. 146111Class i: Low resolution protein structures [58117] (16 folds)
  3. 146112Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 146113Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 146114Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 146115Protein 70S ribosome functional complex [58121] (2 species)
  7. 146143Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)
  8. 146183Domain d1ibks_: 1ibk S: [62182]

Details for d1ibks_

PDB Entry: 1ibk (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
PDB Compounds: (S:)

SCOP Domain Sequences for d1ibks_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibks_ i.1.1.1 (S:) 70S ribosome functional complex {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOP Domain Coordinates for d1ibks_:

Click to download the PDB-style file with coordinates for d1ibks_.
(The format of our PDB-style files is described here.)

Timeline for d1ibks_: