Lineage for d1ibkr_ (1ibk R:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896972Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 897021Domain d1ibkr_: 1ibk R: [62181]

Details for d1ibkr_

PDB Entry: 1ibk (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
PDB Compounds: (R:) 30S ribosomal protein S18

SCOP Domain Sequences for d1ibkr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibkr_ i.1.1.1 (R:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOP Domain Coordinates for d1ibkr_:

Click to download the PDB-style file with coordinates for d1ibkr_.
(The format of our PDB-style files is described here.)

Timeline for d1ibkr_: