SCOPe 2.05: Domain d1ibkq_: 1ibk Q:

Lineage for d1ibkq_ (1ibk Q:)

1. Root: SCOPe 2.05

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein 70S ribosome functional complex [58121] (4 species)

7. Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)

8. Domain d1ibkq_: 1ibk Q: [62180]
   complexed with mg, par, zn

Details for d1ibkq_

PDB Entry: 1ibk, 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin

PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d1ibkq_:

Sequence; same for both SEQRES and ATOM records:

>d1ibkq_ i.1.1.1 (Q:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

Timeline for d1ibkq_:

• d1ibkq_ first appeared in SCOP 1.57
  
• d1ibkq_ appears in SCOPe 2.04
  
• d1ibkq_ appears in SCOPe 2.06
  
• d1ibkq_ appears in the current release, SCOPe 2.08