SCOP 1.71: Domain d1ibkp_: 1ibk P:

Lineage for d1ibkp_ (1ibk P:)

1. Root: SCOP 1.71

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (3 species)

7. Species Thermus thermophilus [TaxId:274] [58122] (10 PDB entries)

8. Domain d1ibkp_: 1ibk P: [62179]

Details for d1ibkp_

PDB Entry: 1ibk, 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin

SCOP Domain Sequences for d1ibkp_:

Sequence; same for both SEQRES and ATOM records:

>d1ibkp_ i.1.1.1 (P:) 70S ribosome functional complex {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

Timeline for d1ibkp_:

• d1ibkp_ first appeared in SCOP 1.57
  
• d1ibkp_ appears in SCOP 1.69
  
• d1ibkp_ appears in SCOP 1.73
  
• d1ibkp_ appears in the current release, SCOPe 2.08