![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
![]() | Protein 70S ribosome functional complex [58121] (9 species) |
![]() | Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries) |
![]() | Domain d1ibkn_: 1ibk N: [62177] complexed with mg, par, zn |
PDB Entry: 1ibk (more details), 3.31 Å
SCOPe Domain Sequences for d1ibkn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ibkn_ i.1.1.1 (N:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]} arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
Timeline for d1ibkn_: