Lineage for d1ibkk_ (1ibk K:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 753710Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 753711Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 753712Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 753713Protein 70S ribosome functional complex [58121] (3 species)
  7. 754252Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)
  8. 754282Domain d1ibkk_: 1ibk K: [62174]

Details for d1ibkk_

PDB Entry: 1ibk (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
PDB Compounds: (K:) 30S ribosomal protein S11

SCOP Domain Sequences for d1ibkk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibkk_ i.1.1.1 (K:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

SCOP Domain Coordinates for d1ibkk_:

Click to download the PDB-style file with coordinates for d1ibkk_.
(The format of our PDB-style files is described here.)

Timeline for d1ibkk_: