Lineage for d1ibkj_ (1ibk J:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1710353Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1710354Protein 70S ribosome functional complex [58121] (9 species)
  7. 1711001Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 1711042Domain d1ibkj_: 1ibk J: [62173]
    complexed with mg, par, zn

Details for d1ibkj_

PDB Entry: 1ibk (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d1ibkj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibkj_ i.1.1.1 (J:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOPe Domain Coordinates for d1ibkj_:

Click to download the PDB-style file with coordinates for d1ibkj_.
(The format of our PDB-style files is described here.)

Timeline for d1ibkj_: