Lineage for d1ibkj_ (1ibk J:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896972Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 897013Domain d1ibkj_: 1ibk J: [62173]

Details for d1ibkj_

PDB Entry: 1ibk (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
PDB Compounds: (J:) 30S ribosomal protein S10

SCOP Domain Sequences for d1ibkj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibkj_ i.1.1.1 (J:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOP Domain Coordinates for d1ibkj_:

Click to download the PDB-style file with coordinates for d1ibkj_.
(The format of our PDB-style files is described here.)

Timeline for d1ibkj_: