Lineage for d1ibkd_ (1ibk D:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 526322Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 526323Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 526324Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 526325Protein 70S ribosome functional complex [58121] (3 species)
  7. 526664Species Thermus thermophilus [TaxId:274] [58122] (10 PDB entries)
  8. 526668Domain d1ibkd_: 1ibk D: [62167]

Details for d1ibkd_

PDB Entry: 1ibk (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin

SCOP Domain Sequences for d1ibkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibkd_ i.1.1.1 (D:) 70S ribosome functional complex {Thermus thermophilus}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOP Domain Coordinates for d1ibkd_:

Click to download the PDB-style file with coordinates for d1ibkd_.
(The format of our PDB-style files is described here.)

Timeline for d1ibkd_: