Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (1 protein) |
Protein 70S ribosome functional complex [58121] (9 species) |
Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries) |
Domain d1ibkc_: 1ibk C: [62166] complexed with mg, par, zn |
PDB Entry: 1ibk (more details), 3.31 Å
SCOPe Domain Sequences for d1ibkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ibkc_ i.1.1.1 (C:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]} gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran idygfalarttygvlgvkayiflgev
Timeline for d1ibkc_: