Lineage for d1ibkb_ (1ibk B:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 432184Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 432185Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 432186Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 432187Protein 70S ribosome functional complex [58121] (2 species)
  7. 432472Species Thermus thermophilus [TaxId:274] [58122] (10 PDB entries)
  8. 432474Domain d1ibkb_: 1ibk B: [62165]

Details for d1ibkb_

PDB Entry: 1ibk (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin

SCOP Domain Sequences for d1ibkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibkb_ i.1.1.1 (B:) 70S ribosome functional complex {Thermus thermophilus}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

SCOP Domain Coordinates for d1ibkb_:

Click to download the PDB-style file with coordinates for d1ibkb_.
(The format of our PDB-style files is described here.)

Timeline for d1ibkb_: