SCOP 1.63: Domain d1ibfa_: 1ibf A:

Lineage for d1ibfa_ (1ibf A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)

7. Species Photobacterium leiognathi [49337] (7 PDB entries)

8. Domain d1ibfa_: 1ibf A: [62158]
   complexed with cu, zn; mutant

Details for d1ibfa_

PDB Entry: 1ibf, 2.2 Å

PDB Description: x-ray 3d structure of p.leiognathi cu,zn sod mutant v29g

SCOP Domain Sequences for d1ibfa_:

Sequence; same for both SEQRES and ATOM records:

>d1ibfa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi}
qdltvkmtdlqtgkpvgtielsqnkygvgfipeladltpgmhgfhihqngscassekdgk
vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
aimihaggdnhsdmpkalggggarvacgviq

Timeline for d1ibfa_:

• d1ibfa_ first appeared in SCOP 1.57
  
• d1ibfa_ appears in SCOP 1.61
  
• d1ibfa_ appears in SCOP 1.65
  
• d1ibfa_ appears in the current release, SCOPe 2.08