Lineage for d1ibba_ (1ibb A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658038Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
    has additional strand at N-terminus
  5. 658039Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 658052Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)
  7. 658262Species Photobacterium leiognathi [TaxId:658] [49337] (9 PDB entries)
  8. 658268Domain d1ibba_: 1ibb A: [62156]
    complexed with cu, zn; mutant

Details for d1ibba_

PDB Entry: 1ibb (more details), 2.1 Å

PDB Description: x-ray 3d structure of p.leiognathi cu,zn sod mutant w83f
PDB Compounds: (A:) cu,zn superoxide dismutase

SCOP Domain Sequences for d1ibba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibba_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 658]}
qdltvkmtdlqtgkpvgtielsqnkygvvfipeladltpgmhgfhihqngscassekdgk
vvlggaagghydpehtnkhgfpftddnhkgdlpalfvsanglatnpvlaprltlkelkgh
aimihaggdnhsdmpkalggggarvacgviq

SCOP Domain Coordinates for d1ibba_:

Click to download the PDB-style file with coordinates for d1ibba_.
(The format of our PDB-style files is described here.)

Timeline for d1ibba_: