Lineage for d1ib5a_ (1ib5 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2763729Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2764343Species Photobacterium leiognathi [TaxId:553611] [49337] (9 PDB entries)
  8. 2764354Domain d1ib5a_: 1ib5 A: [62145]
    complexed with cu, zn; mutant

Details for d1ib5a_

PDB Entry: 1ib5 (more details), 2.45 Å

PDB Description: x-ray 3d structure of p.leiognathi cu,zn sod mutant w83y
PDB Compounds: (A:) cu,zn superoxide dismutase

SCOPe Domain Sequences for d1ib5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ib5a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]}
qdltvkmtdlqtgkpvgtielsqnkygvvfipeladltpgmhgfhihqngscassekdgk
vvlggaagghydpehtnkhgfpytddnhkgdlpalfvsanglatnpvlaprltlkelkgh
aimihaggdnhsdmpkalggggarvacgviq

SCOPe Domain Coordinates for d1ib5a_:

Click to download the PDB-style file with coordinates for d1ib5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ib5a_: