Lineage for d1ib4b_ (1ib4 B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63489Fold b.80: Single-stranded right-handed beta-helix [51125] (3 superfamilies)
  4. 63490Superfamily b.80.1: Pectin lyase-like [51126] (7 families) (S)
  5. 63512Family b.80.1.3: Galacturonase [51137] (2 proteins)
  6. 63513Protein Polygalacturonase [51140] (3 species)
  7. 63516Species Fungus (Aspergillus aculeatus) [TaxId:5053] [63847] (2 PDB entries)
  8. 63519Domain d1ib4b_: 1ib4 B: [62144]

Details for d1ib4b_

PDB Entry: 1ib4 (more details), 2 Å

PDB Description: crystal structure of polygalacturonase from aspergillus aculeatus at ph4.5

SCOP Domain Sequences for d1ib4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ib4b_ b.80.1.3 (B:) Polygalacturonase {Fungus (Aspergillus aculeatus)}
attctfsgsngassasksktscstivlsnvavpsgttldltklndgthvifsgettfgyk
ewsgplisvsgsdltitgasghsingdgsrwwdgeggnggktkpkffaahsltnsvisgl
kivnspvqvfsvagsdyltlkditidnsdgddngghntdafdigtstyvtisgatvynqd
dcvavnsgeniyfsggycsgghglsigsvggrsdntvknvtfvdstiinsdngvriktni
dttgsvsdvtykditltsiakygivvqqnygdtsstpttgvpitdfvldnvhgsvvssgt
niliscgsgscsdwtwtdvsvsggktsskctnvpsgasc

SCOP Domain Coordinates for d1ib4b_:

Click to download the PDB-style file with coordinates for d1ib4b_.
(The format of our PDB-style files is described here.)

Timeline for d1ib4b_: