SCOPe 2.06: Domain d1ib4a_: 1ib4 A:

Lineage for d1ib4a_ (1ib4 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.1: Pectin lyase-like [51126] (12 families)
   superhelix turns are made of 3 strands each

5. Family b.80.1.3: Galacturonase [51137] (3 proteins)
   this is a repeat family; one repeat unit is 1bhe A:244-269 found in domain

6. Protein Polygalacturonase [51140] (6 species)

7. Species Fungus (Aspergillus aculeatus) [TaxId:5053] [63847] (2 PDB entries)

8. Domain d1ib4a_: 1ib4 A: [62143]
   complexed with cd, man

Details for d1ib4a_

PDB Entry: 1ib4, 2 Å

PDB Description: crystal structure of polygalacturonase from aspergillus aculeatus at ph4.5

PDB Compounds: (A:) polygalacturonase

SCOPe Domain Sequences for d1ib4a_:

Sequence; same for both SEQRES and ATOM records:

>d1ib4a_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
attctfsgsngassasksktscstivlsnvavpsgttldltklndgthvifsgettfgyk
ewsgplisvsgsdltitgasghsingdgsrwwdgeggnggktkpkffaahsltnsvisgl
kivnspvqvfsvagsdyltlkditidnsdgddngghntdafdigtstyvtisgatvynqd
dcvavnsgeniyfsggycsgghglsigsvggrsdntvknvtfvdstiinsdngvriktni
dttgsvsdvtykditltsiakygivvqqnygdtsstpttgvpitdfvldnvhgsvvssgt
niliscgsgscsdwtwtdvsvsggktsskctnvpsgasc

Timeline for d1ib4a_:

• d1ib4a_ first appeared in SCOP 1.57
  
• d1ib4a_ appears in SCOPe 2.05
  
• d1ib4a_ appears in SCOPe 2.07
  
• d1ib4a_ appears in the current release, SCOPe 2.08