![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.80: Single-stranded right-handed beta-helix [51125] (7 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.80.1: Pectin lyase-like [51126] (11 families) ![]() superhelix turns are made of 3 strands each |
![]() | Family b.80.1.3: Galacturonase [51137] (2 proteins) this is a repeat family; one repeat unit is 1bhe A:244-269 found in domain |
![]() | Protein Polygalacturonase [51140] (6 species) |
![]() | Species Fungus (Aspergillus aculeatus) [TaxId:5053] [63847] (2 PDB entries) |
![]() | Domain d1ib4a_: 1ib4 A: [62143] |
PDB Entry: 1ib4 (more details), 2 Å
SCOP Domain Sequences for d1ib4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ib4a_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus aculeatus)} attctfsgsngassasksktscstivlsnvavpsgttldltklndgthvifsgettfgyk ewsgplisvsgsdltitgasghsingdgsrwwdgeggnggktkpkffaahsltnsvisgl kivnspvqvfsvagsdyltlkditidnsdgddngghntdafdigtstyvtisgatvynqd dcvavnsgeniyfsggycsgghglsigsvggrsdntvknvtfvdstiinsdngvriktni dttgsvsdvtykditltsiakygivvqqnygdtsstpttgvpitdfvldnvhgsvvssgt niliscgsgscsdwtwtdvsvsggktsskctnvpsgasc
Timeline for d1ib4a_: