Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
Protein Serotonin N-acetyltranferase [55746] (1 species) |
Species Sheep (Ovis aries) [TaxId:9940] [55747] (7 PDB entries) |
Domain d1ib1e_: 1ib1 E: [62137] Other proteins in same PDB: d1ib1a_, d1ib1b_, d1ib1c_, d1ib1d_ complexed with cot |
PDB Entry: 1ib1 (more details), 2.7 Å
SCOPe Domain Sequences for d1ib1e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ib1e_ d.108.1.1 (E:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} sgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlc pelslgwfvegrlvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgs vllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslr
Timeline for d1ib1e_: