Lineage for d1ib1e_ (1ib1 E:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426873Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1426874Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1426875Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1427192Protein Serotonin N-acetyltranferase [55746] (1 species)
  7. 1427193Species Sheep (Ovis aries) [TaxId:9940] [55747] (7 PDB entries)
  8. 1427201Domain d1ib1e_: 1ib1 E: [62137]
    Other proteins in same PDB: d1ib1a_, d1ib1b_, d1ib1c_, d1ib1d_
    complexed with cot

Details for d1ib1e_

PDB Entry: 1ib1 (more details), 2.7 Å

PDB Description: crystal structure of the 14-3-3 zeta:serotonin n-acetyltransferase complex
PDB Compounds: (E:) serotonin n-acetyltransferase

SCOPe Domain Sequences for d1ib1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ib1e_ d.108.1.1 (E:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]}
sgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlc
pelslgwfvegrlvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgs
vllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslr

SCOPe Domain Coordinates for d1ib1e_:

Click to download the PDB-style file with coordinates for d1ib1e_.
(The format of our PDB-style files is described here.)

Timeline for d1ib1e_: