Lineage for d1ib1e_ (1ib1 E:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136612Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
  4. 136613Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (2 families) (S)
  5. 136614Family d.108.1.1: N-acetyl transferase, NAT [55730] (9 proteins)
  6. 136667Protein Serotonin N-acetyltranferase [55746] (1 species)
  7. 136668Species Sheep (Ovis aries) [TaxId:9940] [55747] (3 PDB entries)
  8. 136672Domain d1ib1e_: 1ib1 E: [62137]
    Other proteins in same PDB: d1ib1a_, d1ib1b_, d1ib1c_, d1ib1d_

Details for d1ib1e_

PDB Entry: 1ib1 (more details), 2.7 Å

PDB Description: crystal structure of the 14-3-3 zeta:serotonin n-acetyltransferase complex

SCOP Domain Sequences for d1ib1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ib1e_ d.108.1.1 (E:) Serotonin N-acetyltranferase {Sheep (Ovis aries)}
sgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlc
pelslgwfvegrlvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgs
vllwrylhhvgaqpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslr

SCOP Domain Coordinates for d1ib1e_:

Click to download the PDB-style file with coordinates for d1ib1e_.
(The format of our PDB-style files is described here.)

Timeline for d1ib1e_: