Lineage for d1ib1c_ (1ib1 C:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647251Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
  5. 647252Family a.118.7.1: 14-3-3 protein [48446] (2 proteins)
  6. 647261Protein zeta isoform [48449] (2 species)
  7. 647271Species Human (Homo sapiens) [TaxId:9606] [48451] (5 PDB entries)
  8. 647282Domain d1ib1c_: 1ib1 C: [62135]
    Other proteins in same PDB: d1ib1e_, d1ib1f_, d1ib1g_, d1ib1h_

Details for d1ib1c_

PDB Entry: 1ib1 (more details), 2.7 Å

PDB Description: crystal structure of the 14-3-3 zeta:serotonin n-acetyltransferase complex
PDB Compounds: (C:) 14-3-3 zeta isoform

SCOP Domain Sequences for d1ib1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ib1c_ a.118.7.1 (C:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
dknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswrv
vssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlw

SCOP Domain Coordinates for d1ib1c_:

Click to download the PDB-style file with coordinates for d1ib1c_.
(The format of our PDB-style files is described here.)

Timeline for d1ib1c_: