Lineage for d1ib1b_ (1ib1 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339527Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2339528Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2339547Protein zeta isoform [48449] (2 species)
  7. 2339557Species Human (Homo sapiens) [TaxId:9606] [48451] (12 PDB entries)
  8. 2339583Domain d1ib1b_: 1ib1 B: [62134]
    Other proteins in same PDB: d1ib1e_, d1ib1f_, d1ib1g_, d1ib1h_
    complexed to serotonin N-acetyltransferase
    complexed with cot

Details for d1ib1b_

PDB Entry: 1ib1 (more details), 2.7 Å

PDB Description: crystal structure of the 14-3-3 zeta:serotonin n-acetyltransferase complex
PDB Compounds: (B:) 14-3-3 zeta isoform

SCOPe Domain Sequences for d1ib1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ib1b_ a.118.7.1 (B:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
dknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswrv
vssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlw

SCOPe Domain Coordinates for d1ib1b_:

Click to download the PDB-style file with coordinates for d1ib1b_.
(The format of our PDB-style files is described here.)

Timeline for d1ib1b_: