Lineage for d1ib1a_ (1ib1 A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775740Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
  5. 775741Family a.118.7.1: 14-3-3 protein [48446] (4 proteins)
  6. 775757Protein zeta isoform [48449] (2 species)
  7. 775773Species Human (Homo sapiens) [TaxId:9606] [48451] (5 PDB entries)
  8. 775780Domain d1ib1a_: 1ib1 A: [62133]
    Other proteins in same PDB: d1ib1e_, d1ib1f_, d1ib1g_, d1ib1h_
    complexed to serotonin N-acetyltransferase

Details for d1ib1a_

PDB Entry: 1ib1 (more details), 2.7 Å

PDB Description: crystal structure of the 14-3-3 zeta:serotonin n-acetyltransferase complex
PDB Compounds: (A:) 14-3-3 zeta isoform

SCOP Domain Sequences for d1ib1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ib1a_ a.118.7.1 (A:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
dknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswrv
vssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm
kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei
lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlw

SCOP Domain Coordinates for d1ib1a_:

Click to download the PDB-style file with coordinates for d1ib1a_.
(The format of our PDB-style files is described here.)

Timeline for d1ib1a_: