SCOPe 2.05: Domain d1iazb_: 1iaz B:

Lineage for d1iazb_ (1iaz B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
   sandwich, 10 strands in 2 sheets;

4. Superfamily b.97.1: Cytolysin/lectin [63724] (2 families)
   some topological similarity to osmotin

5. Family b.97.1.1: Anemone pore-forming cytolysin [63725] (3 proteins)
   Pfam PF06369

6. Protein Equinatoxin II (eqtII, tenebrosin C) [63726] (1 species)

7. Species European sea anemone (Actinia equina) [TaxId:6106] [63727] (3 PDB entries)
   Uniprot P61914 40-214

8. Domain d1iazb_: 1iaz B: [62132]
   complexed with so4

Details for d1iazb_

PDB Entry: 1iaz, 1.9 Å

PDB Description: equinatoxin ii

PDB Compounds: (B:) equinatoxin II

SCOPe Domain Sequences for d1iazb_:

Sequence; same for both SEQRES and ATOM records:

>d1iazb_ b.97.1.1 (B:) Equinatoxin II (eqtII, tenebrosin C) {European sea anemone (Actinia equina) [TaxId: 6106]}
agavidgaslsfdilktvlealgnvkrkiavgvdnesgktwtalntyfrsgtsdivlphk
vphgkallyngqkdrgpvatgavgvlaylmsdgntlavlfsvpydynwysnwwnvriykg
krradqrmyeelyynlspfrgdngwhtrnlgyglksrgfmnssghaileihvska

Timeline for d1iazb_:

• d1iazb_ first appeared in SCOP 1.57
  
• d1iazb_ appears in SCOPe 2.04
  
• d1iazb_ appears in SCOPe 2.06
  
• d1iazb_ appears in the current release, SCOPe 2.08