| Class b: All beta proteins [48724] (176 folds) |
| Fold b.97: Cytolysin/lectin [63723] (1 superfamily) sandwich, 10 strands in 2 sheets; |
Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) ![]() some topological similarity to osmotin |
| Family b.97.1.1: Anemone pore-forming cytolysin [63725] (3 proteins) Pfam PF06369 |
| Protein Equinatoxin II (eqtII, tenebrosin C) [63726] (1 species) |
| Species European sea anemone (Actinia equina) [TaxId:6106] [63727] (3 PDB entries) Uniprot P61914 40-214 |
| Domain d1iazb_: 1iaz B: [62132] complexed with so4 |
PDB Entry: 1iaz (more details), 1.9 Å
SCOPe Domain Sequences for d1iazb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iazb_ b.97.1.1 (B:) Equinatoxin II (eqtII, tenebrosin C) {European sea anemone (Actinia equina) [TaxId: 6106]}
agavidgaslsfdilktvlealgnvkrkiavgvdnesgktwtalntyfrsgtsdivlphk
vphgkallyngqkdrgpvatgavgvlaylmsdgntlavlfsvpydynwysnwwnvriykg
krradqrmyeelyynlspfrgdngwhtrnlgyglksrgfmnssghaileihvska
Timeline for d1iazb_: