Lineage for d1iazb_ (1iaz B:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.97: Equinatoxin II (eqtII, tenebrosin C) [63723] (1 superfamily) Superfamily b.97.1: Equinatoxin II (eqtII, tenebrosin C) [63724] (1 family) 
Family b.97.1.1: Equinatoxin II (eqtII, tenebrosin C) [63725] (1 protein) Protein Equinatoxin II (eqtII, tenebrosin C) [63726] (1 species) Species European sea anemone (Actinia equina) [TaxId:6106] [63727] (1 PDB entry) 
Domain d1iazb_: 1iaz B: [62132]
Details for d1iazb_
PDB Entry: 1iaz (more details), 1.9 Å
PDB Description: equinatoxin ii
SCOP Domain Sequences for d1iazb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iazb_ b.97.1.1 (B:) Equinatoxin II (eqtII, tenebrosin C) {European sea anemone (Actinia equina)}
agavidgaslsfdilktvlealgnvkrkiavgvdnesgktwtalntyfrsgtsdivlphk
vphgkallyngqkdrgpvatgavgvlaylmsdgntlavlfsvpydynwysnwwnvriykg
krradqrmyeelyynlspfrgdngwhtrnlgyglksrgfmnssghaileihvska
SCOP Domain Coordinates for d1iazb_:
Click to download the PDB-style file with coordinates for d1iazb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iazb_:
- d1iazb_ is new in SCOP 1.57
- d1iazb_ appears in SCOP 1.59
- d1iazb_ appears in the current release, SCOPe 2.08
View in 3D
