Lineage for d1iazb_ (1iaz B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820489Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
    sandwich, 10 strands in 2 sheets;
  4. 2820490Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) (S)
    some topological similarity to osmotin
  5. 2820491Family b.97.1.1: Anemone pore-forming cytolysin [63725] (3 proteins)
    Pfam PF06369
  6. 2820492Protein Equinatoxin II (eqtII, tenebrosin C) [63726] (1 species)
  7. 2820493Species European sea anemone (Actinia equina) [TaxId:6106] [63727] (3 PDB entries)
    Uniprot P61914 40-214
  8. 2820496Domain d1iazb_: 1iaz B: [62132]
    complexed with so4

Details for d1iazb_

PDB Entry: 1iaz (more details), 1.9 Å

PDB Description: equinatoxin ii
PDB Compounds: (B:) equinatoxin II

SCOPe Domain Sequences for d1iazb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iazb_ b.97.1.1 (B:) Equinatoxin II (eqtII, tenebrosin C) {European sea anemone (Actinia equina) [TaxId: 6106]}
agavidgaslsfdilktvlealgnvkrkiavgvdnesgktwtalntyfrsgtsdivlphk
vphgkallyngqkdrgpvatgavgvlaylmsdgntlavlfsvpydynwysnwwnvriykg
krradqrmyeelyynlspfrgdngwhtrnlgyglksrgfmnssghaileihvska

SCOPe Domain Coordinates for d1iazb_:

Click to download the PDB-style file with coordinates for d1iazb_.
(The format of our PDB-style files is described here.)

Timeline for d1iazb_: