Class b: All beta proteins [48724] (178 folds) |
Fold b.97: Cytolysin/lectin [63723] (1 superfamily) sandwich, 10 strands in 2 sheets; |
Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) some topological similarity to osmotin |
Family b.97.1.1: Anemone pore-forming cytolysin [63725] (3 proteins) Pfam PF06369 |
Protein Equinatoxin II (eqtII, tenebrosin C) [63726] (1 species) |
Species European sea anemone (Actinia equina) [TaxId:6106] [63727] (3 PDB entries) Uniprot P61914 40-214 |
Domain d1iaza_: 1iaz A: [62131] complexed with so4 |
PDB Entry: 1iaz (more details), 1.9 Å
SCOPe Domain Sequences for d1iaza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iaza_ b.97.1.1 (A:) Equinatoxin II (eqtII, tenebrosin C) {European sea anemone (Actinia equina) [TaxId: 6106]} agavidgaslsfdilktvlealgnvkrkiavgvdnesgktwtalntyfrsgtsdivlphk vphgkallyngqkdrgpvatgavgvlaylmsdgntlavlfsvpydynwysnwwnvriykg krradqrmyeelyynlspfrgdngwhtrnlgyglksrgfmnssghaileihvska
Timeline for d1iaza_: