Lineage for d1iava_ (1iav A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180427Fold c.41: Subtilisin-like [52742] (1 superfamily)
  4. 180428Superfamily c.41.1: Subtilisin-like [52743] (2 families) (S)
  5. 180429Family c.41.1.1: Subtilases [52744] (8 proteins)
  6. 180448Protein Serine protease PB92 (subtilisin PB92) [52756] (1 species)
  7. 180449Species Bacillus alcalophilus, Bacillus lentus [52757] (2 PDB entries)
  8. 180450Domain d1iava_: 1iav A: [62125]

Details for d1iava_

PDB Entry: 1iav (more details), 1.8 Å

PDB Description: structure on native (asn 87) subtilisin from bacillus lentus

SCOP Domain Sequences for d1iava_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iava_ c.41.1.1 (A:) Serine protease PB92 (subtilisin PB92) {Bacillus alcalophilus, Bacillus lentus}
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapnaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaatr

SCOP Domain Coordinates for d1iava_:

Click to download the PDB-style file with coordinates for d1iava_.
(The format of our PDB-style files is described here.)

Timeline for d1iava_: