Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.41: Subtilisin-like [52742] (1 superfamily) |
Superfamily c.41.1: Subtilisin-like [52743] (2 families) |
Family c.41.1.1: Subtilases [52744] (8 proteins) |
Protein Serine protease PB92 (subtilisin PB92) [52756] (1 species) |
Species Bacillus alcalophilus, Bacillus lentus [52757] (2 PDB entries) |
Domain d1iava_: 1iav A: [62125] |
PDB Entry: 1iav (more details), 1.8 Å
SCOP Domain Sequences for d1iava_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iava_ c.41.1.1 (A:) Serine protease PB92 (subtilisin PB92) {Bacillus alcalophilus, Bacillus lentus} aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn ghgthvagtiaalnnsigvlgvapnaelyavkvlgasgsgsvssiaqglewagnngmhva nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi rnhlkntatslgstnlygsglvnaeaatr
Timeline for d1iava_: