Lineage for d1iaua_ (1iau A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1793906Protein Granzyme B [50590] (2 species)
  7. 1793907Species Human (Homo sapiens) [TaxId:9606] [50592] (2 PDB entries)
  8. 1793908Domain d1iaua_: 1iau A: [62124]
    complexed with nag, zn

Details for d1iaua_

PDB Entry: 1iau (more details), 2 Å

PDB Description: human granzyme b in complex with ac-iepd-cho
PDB Compounds: (A:) granzyme b

SCOPe Domain Sequences for d1iaua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iaua_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]}
iiggheakphsrpymaylmiwdqkslkrcggflirddfvltaahcwgssinvtlgahnik
eqeptqqfipvkrpiphpaynpknfsndimllqlerkakrtravqplrlpsnkaqvkpgq
tcsvagwgqtaplgkhshtlqevkmtvqedrkcesdlrhyydstielcvgdpeikktsfk
gdsggplvcnkvaqgivsygrnngmppractkvssfvhwikktmkr

SCOPe Domain Coordinates for d1iaua_:

Click to download the PDB-style file with coordinates for d1iaua_.
(The format of our PDB-style files is described here.)

Timeline for d1iaua_: