Lineage for d1iaua_ (1iau A:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins) 
Protein Granzyme B [50590] (2 species) Species Human (Homo sapiens) [TaxId:9606] [50592] (2 PDB entries) 
Domain d1iaua_: 1iau A: [62124]
Details for d1iaua_
PDB Entry: 1iau (more details), 2 Å
PDB Description: human granzyme b in complex with ac-iepd-cho
SCOP Domain Sequences for d1iaua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iaua_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens)}
iiggheakphsrpymaylmiwdqkslkrcggflirddfvltaahcwgssinvtlgahnik
eqeptqqfipvkrpiphpaynpknfsndimllqlerkakrtravqplrlpsnkaqvkpgq
tcsvagwgqtaplgkhshtlqevkmtvqedrkcesdlrhyydstielcvgdpeikktsfk
gdsggplvcnkvaqgivsygrnngmppractkvssfvhwikktmkr
SCOP Domain Coordinates for d1iaua_:
Click to download the PDB-style file with coordinates for d1iaua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iaua_:
- d1iaua_ is new in SCOP 1.57
- d1iaua_ appears in SCOP 1.59
- d1iaua_ appears in the current release, SCOPe 2.08
View in 3D