Lineage for d1iaqb_ (1iaq B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69650Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 69682Protein cH-p21 Ras protein [52593] (1 species)
  7. 69683Species Human (Homo sapiens) [TaxId:9606] [52594] (34 PDB entries)
  8. 69716Domain d1iaqb_: 1iaq B: [62121]

Details for d1iaqb_

PDB Entry: 1iaq (more details), 2.9 Å

PDB Description: c-h-ras p21 protein mutant with thr 35 replaced by ser (t35s) complexed with guanosine-5'-[b,g-imido] triphosphate
PDB Compounds: (B:)

SCOP Domain Sequences for d1iaqb_:

Sequence, based on SEQRES records: (download)

>d1iaqb_ c.37.1.8 (B:) cH-p21 Ras protein {Human (Homo sapiens)}
mteyklvvvgaggvgksaltiqliqnhfvdeydpsiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Sequence, based on observed residues (ATOM records): (download)

>d1iaqb_ c.37.1.8 (B:) cH-p21 Ras protein {Human (Homo sapiens)}
mteyklvvvgaggvgksaltiqliqnhfvsyrkqvvidgetclldildtagqrdqymrtg
egflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesrqaqdlar
sygipyietsaktrqgvedafytlvreirqh

SCOP Domain Coordinates for d1iaqb_:

Click to download the PDB-style file with coordinates for d1iaqb_.
(The format of our PDB-style files is described here.)

Timeline for d1iaqb_: