Lineage for d1iapa_ (1iap A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004960Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2004961Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2004962Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 2004981Protein p115RhoGEF [63584] (1 species)
  7. 2004982Species Human (Homo sapiens) [TaxId:9606] [63585] (1 PDB entry)
  8. 2004983Domain d1iapa_: 1iap A: [62119]
    N-terminal RGS domain

Details for d1iapa_

PDB Entry: 1iap (more details), 1.9 Å

PDB Description: crystal structure of p115rhogef rgrgs domain
PDB Compounds: (A:) guanine nucleotide exchange factor p115rhogef

SCOPe Domain Sequences for d1iapa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iapa_ a.91.1.1 (A:) p115RhoGEF {Human (Homo sapiens) [TaxId: 9606]}
sqfqsleqvkrrpahlmallqhvalqfepgpllcclhadmlgslgpkeakkafldfyhsf
lektavlrvpvppnvafeldrtradlisedvqrrfvqevvqsqqvavgrqledfrskrlm
gmtpweqelaqleawvgrdrasyearerhvaerllmhleemqhtistdeeksaavvnaig
lymrhlgvrt

SCOPe Domain Coordinates for d1iapa_:

Click to download the PDB-style file with coordinates for d1iapa_.
(The format of our PDB-style files is described here.)

Timeline for d1iapa_: