Lineage for d1iapa_ (1iap A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283641Fold a.91: Regulator of G-protein signalling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 283642Superfamily a.91.1: Regulator of G-protein signalling, RGS [48097] (1 family) (S)
  5. 283643Family a.91.1.1: Regulator of G-protein signalling, RGS [48098] (7 proteins)
  6. 283654Protein p115RhoGEF [63584] (1 species)
  7. 283655Species Human (Homo sapiens) [TaxId:9606] [63585] (1 PDB entry)
  8. 283656Domain d1iapa_: 1iap A: [62119]
    N-terminal RGS domain

Details for d1iapa_

PDB Entry: 1iap (more details), 1.9 Å

PDB Description: crystal structure of p115rhogef rgrgs domain

SCOP Domain Sequences for d1iapa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iapa_ a.91.1.1 (A:) p115RhoGEF {Human (Homo sapiens)}
sqfqsleqvkrrpahlmallqhvalqfepgpllcclhadmlgslgpkeakkafldfyhsf
lektavlrvpvppnvafeldrtradlisedvqrrfvqevvqsqqvavgrqledfrskrlm
gmtpweqelaqleawvgrdrasyearerhvaerllmhleemqhtistdeeksaavvnaig
lymrhlgvrt

SCOP Domain Coordinates for d1iapa_:

Click to download the PDB-style file with coordinates for d1iapa_.
(The format of our PDB-style files is described here.)

Timeline for d1iapa_: