Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.5: MHCK/EF2 kinase [64408] (1 protein) Atypical protein kinases |
Protein Trp Ca-channel kinase domain [64409] (1 species) contains closed beta-barrel (n=6; S=10) in the N-terminal subdomain |
Species Mouse (Mus musculus) [TaxId:10090] [64410] (3 PDB entries) |
Domain d1iajb_: 1iaj B: [62118] complexed with zn |
PDB Entry: 1iaj (more details), 2.8 Å
SCOPe Domain Sequences for d1iajb_:
Sequence, based on SEQRES records: (download)
>d1iajb_ d.144.1.5 (B:) Trp Ca-channel kinase domain {Mouse (Mus musculus) [TaxId: 10090]} yyysavernnlmrlsqsipfvpvpprgepvtvyrleesspsilnnsmsswsqlglcakie flskeemggglrravkvlctwsehdilksghlyiiksflpevintwssiykedtvlhlcl reiqqqraaqkltfafnqmkpksipysprflevfllychsagqwfaveecmtgefrkynn nngdeiiptntleeimlafshwtyeytrgellvldlqgvgenltdpsvikaeekrscdmv fgpanlgedaiknfrakhhcnsccrklklpdlkrndyt
>d1iajb_ d.144.1.5 (B:) Trp Ca-channel kinase domain {Mouse (Mus musculus) [TaxId: 10090]} yyysavernnlmrlsqsipfvpvpprgepvtvyrleesspsilnnsmsswsqlglcakie flskeemgrravkvlctwsehdilksghlyiiksflpevintwkedtvlhlclreiqqqr aaqkltfafnqmkpksipysprflevfllychsagqwfaveecmtgefrkynnnngdeii ptntleeimlafshwtyeytrgellvldlqgvgenltdpsvikaenlgedaiknfrakhh cnsccrklklpdlkrndyt
Timeline for d1iajb_: