![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) ![]() |
![]() | Family d.144.1.5: MHCK/EF2 kinase [64408] (1 protein) |
![]() | Protein Trp Ca-channel kinase domain [64409] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [64410] (3 PDB entries) |
![]() | Domain d1iahb_: 1iah B: [62116] |
PDB Entry: 1iah (more details), 2.4 Å
SCOP Domain Sequences for d1iahb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iahb_ d.144.1.5 (B:) Trp Ca-channel kinase domain {Mouse (Mus musculus)} tnyyysavernnlmrlsqsipfvpvpprgepvtvyrleesspsilnnsmsswsqlglcak ieflskeemggglrravkvlctwsehdilksghlyiiksflpevintwssiykedtvlhl clreiqqqraaqkltfafnqmkpksipysprflevfllychsagqwfaveecmtgefrky nnnngdeiiptntleeimlafshwtyeytrgellvldlqgvgenltdpsvikaeekrscd mvfgpanlgedaiknfrakhhcnsccrklklpdlkrndyt
Timeline for d1iahb_: