SCOP 1.57: Domain d1iahb_: 1iah B:

Lineage for d1iahb_ (1iah B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families)

5. Family d.144.1.5: MHCK/EF2 kinase [64408] (1 protein)

6. Protein Trp Ca-channel kinase domain [64409] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [64410] (3 PDB entries)

8. Domain d1iahb_: 1iah B: [62116]

Details for d1iahb_

PDB Entry: 1iah, 2.4 Å

PDB Description: crystal structure of the atypical protein kinase domain of a trp ca-channel, chak (adp-mg complex)

SCOP Domain Sequences for d1iahb_:

Sequence; same for both SEQRES and ATOM records:

>d1iahb_ d.144.1.5 (B:) Trp Ca-channel kinase domain {Mouse (Mus musculus)}
tnyyysavernnlmrlsqsipfvpvpprgepvtvyrleesspsilnnsmsswsqlglcak
ieflskeemggglrravkvlctwsehdilksghlyiiksflpevintwssiykedtvlhl
clreiqqqraaqkltfafnqmkpksipysprflevfllychsagqwfaveecmtgefrky
nnnngdeiiptntleeimlafshwtyeytrgellvldlqgvgenltdpsvikaeekrscd
mvfgpanlgedaiknfrakhhcnsccrklklpdlkrndyt

Timeline for d1iahb_:

• d1iahb_ is new in SCOP 1.57
  
• d1iahb_ appears in SCOP 1.59
  
• d1iahb_ appears in the current release, SCOPe 2.08