Lineage for d1ia9b_ (1ia9 B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138043Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 138044Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 138280Family d.144.1.5: MHCK/EF2 kinase [64408] (1 protein)
  6. 138281Protein Trp Ca-channel kinase domain [64409] (1 species)
  7. 138282Species Mouse (Mus musculus) [TaxId:10090] [64410] (3 PDB entries)
  8. 138284Domain d1ia9b_: 1ia9 B: [62114]

Details for d1ia9b_

PDB Entry: 1ia9 (more details), 2 Å

PDB Description: crystal structure of the atypical protein kinase domain of a trp ca-channel, chak (amppnp complex)

SCOP Domain Sequences for d1ia9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ia9b_ d.144.1.5 (B:) Trp Ca-channel kinase domain {Mouse (Mus musculus)}
tnyyysavernnlmrlsqsipfvpvpprgepvtvyrleesspsilnnsmsswsqlglcak
ieflskeemggglrravkvlctwsehdilksghlyiiksflpevintwssiykedtvlhl
clreiqqqraaqkltfafnqmkpksipysprflevfllychsagqwfaveecmtgefrky
nnnngdeiiptntleeimlafshwtyeytrgellvldlqgvgenltdpsvikaeekrscd
mvfgpanlgedaiknfrakhhcnsccrklklpdlkrndyt

SCOP Domain Coordinates for d1ia9b_:

Click to download the PDB-style file with coordinates for d1ia9b_.
(The format of our PDB-style files is described here.)

Timeline for d1ia9b_: