Lineage for d1ia9a_ (1ia9 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262793Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 262794Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 263121Family d.144.1.5: MHCK/EF2 kinase [64408] (1 protein)
    Atypical protein kinases
  6. 263122Protein Trp Ca-channel kinase domain [64409] (1 species)
    contains closed beta-barrel (n=6; S=10) in the N-terminal subdomain
  7. 263123Species Mouse (Mus musculus) [TaxId:10090] [64410] (3 PDB entries)
  8. 263124Domain d1ia9a_: 1ia9 A: [62113]

Details for d1ia9a_

PDB Entry: 1ia9 (more details), 2 Å

PDB Description: crystal structure of the atypical protein kinase domain of a trp ca-channel, chak (amppnp complex)

SCOP Domain Sequences for d1ia9a_:

Sequence, based on SEQRES records: (download)

>d1ia9a_ d.144.1.5 (A:) Trp Ca-channel kinase domain {Mouse (Mus musculus)}
yyysavernnlmrlsqsipfvpvpprgepvtvyrleesspsilnnsmsswsqlglcakie
flskeemggglrravkvlctwsehdilksghlyiiksflpevintwssiykedtvlhlcl
reiqqqraaqkltfafnqmkpksipysprflevfllychsagqwfaveecmtgefrkynn
nngdeiiptntleeimlafshwtyeytrgellvldlqgvgenltdpsvikaeekrscdmv
fgpanlgedaiknfrakhhcnsccrklklpdlkrndyt

Sequence, based on observed residues (ATOM records): (download)

>d1ia9a_ d.144.1.5 (A:) Trp Ca-channel kinase domain {Mouse (Mus musculus)}
yyysavernnlmrlsqsipfvpvpprgepvtvyrleesspsilnnsmsswsqlglcakie
flskmggglrravkvlctwsehdilksghlyiiksflpevintwssiykedtvlhlclre
iqqqraaqkltfafnqmkpksipysprflevfllychsagqwfaveecmtgefrkynnnn
gdeiiptntleeimlafshwtyeytrgellvldlqgvgenltdpsvikaeekrscdmvfg
panlgedaiknfrakhhcnsccrklklpdlkrndyt

SCOP Domain Coordinates for d1ia9a_:

Click to download the PDB-style file with coordinates for d1ia9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ia9a_: