Lineage for d1ia8a_ (1ia8 A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138043Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 138044Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 138045Family d.144.1.1: Serine/threonin kinases [56113] (17 proteins)
  6. 138085Protein Cell cycle checkpoint kinase chk1 [64404] (1 species)
  7. 138086Species Human (Homo sapiens) [TaxId:9606] [64405] (1 PDB entry)
  8. 138087Domain d1ia8a_: 1ia8 A: [62112]

Details for d1ia8a_

PDB Entry: 1ia8 (more details), 1.7 Å

PDB Description: the 1.7 a crystal structure of human cell cycle checkpoint kinase chk1

SCOP Domain Sequences for d1ia8a_:

Sequence, based on SEQRES records: (download)

>d1ia8a_ d.144.1.1 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens)}
avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
lhkilvenpsaritipdikkdrwynkplkkgakrp

Sequence, based on observed residues (ATOM records): (download)

>d1ia8a_ d.144.1.1 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens)}
avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkrcpenikkeicinkmlnh
envvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgi
githrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrref
haepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhk
ilvenpsaritipdikkdrwynkplkkgakrp

SCOP Domain Coordinates for d1ia8a_:

Click to download the PDB-style file with coordinates for d1ia8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ia8a_: