SCOPe 2.07: Domain d1ia2a_: 1ia2 A:

Lineage for d1ia2a_ (1ia2 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [53609] (17 PDB entries)

8. Domain d1ia2a_: 1ia2 A: [62105]
   complexed with mes, ndp, tq4

Details for d1ia2a_

PDB Entry: 1ia2, 1.82 Å

PDB Description: candida albicans dihydrofolate reductase complexed with dihydro- nicotinamide-adenine-dinucleotide phosphate (nadph) and 5-[(4- methylphenyl)sulfanyl]-2,4-quinazolinediamine (gw578)

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1ia2a_:

Sequence; same for both SEQRES and ATOM records:

>d1ia2a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
dftynytlwtrk

Timeline for d1ia2a_:

• d1ia2a_ first appeared in SCOP 1.57
  
• d1ia2a_ appears in SCOPe 2.06
  
• d1ia2a_ appears in the current release, SCOPe 2.08