Lineage for d1ia1a_ (1ia1 A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.71: Dihydrofolate reductases [53596] (1 superfamily) Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) 
Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) 
Protein Dihydrofolate reductases, eukaryotic type [53605] (4 species) Species Yeast (Candida albicans) [TaxId:5476] [53609] (6 PDB entries) 
Domain d1ia1a_: 1ia1 A: [62103]
Details for d1ia1a_
PDB Entry: 1ia1 (more details), 1.7 Å
PDB Description: candida albicans dihydrofolate reductase complexed with dihydro- nicotinamide-adenine-dinucleotide phosphate (nadph) and 5- (phenylsulfanyl)-2,4-quinazolinediamine (gw997)
SCOP Domain Sequences for d1ia1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ia1a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans)}
mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
dftynytlwtrk
SCOP Domain Coordinates for d1ia1a_:
Click to download the PDB-style file with coordinates for d1ia1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ia1a_:
- d1ia1a_ first appeared in SCOP 1.57
- d1ia1a_ appears in SCOP 1.61
- d1ia1a_ appears in the current release, SCOPe 2.08
View in 3D
