Lineage for d1i9za_ (1i9z A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676253Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 1676254Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 1676326Family d.151.1.2: Inositol polyphosphate 5-phosphatase (IPP5) [64422] (3 proteins)
  6. 1676331Protein Synaptojanin, IPP5C domain [64423] (1 species)
  7. 1676332Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [64424] (2 PDB entries)
  8. 1676333Domain d1i9za_: 1i9z A: [62102]
    complexed with 2ip, ca

Details for d1i9za_

PDB Entry: 1i9z (more details), 1.8 Å

PDB Description: crystal structure of inositol polyphosphate 5-phosphatase domain (ipp5c) of spsynaptojanin in complex with inositol (1,4)-bisphosphate and calcium ion
PDB Compounds: (A:) phosphatidylinositol phosphate phosphatase

SCOPe Domain Sequences for d1i9za_:

Sequence, based on SEQRES records: (download)

>d1i9za_ d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
ydpiheyvnhelrkrenefsehknvkifvasynlngcsattklenwlfpentpladiyvv
gfqeivqltpqqvisadpakrrewescvkrllngkctsgpgyvqlrsgqlvgtalmifck
esclpsiknvegtvkktglggvsgnkgavairfdyedtglcfitshlaagytnyderdhd
yrtiasglrfrrgrsifnhdyvvwfgdfnyrisltyeevvpciaqgklsylfeydqlnkq
mltgkvfpffselpitfpptykfdigtdiydtsdkhrvpawtdrilyrgelvphsyqsvp
lyysdhrpiyatyeanivkvdrekkkilfeelynqrkqevrdasq

Sequence, based on observed residues (ATOM records): (download)

>d1i9za_ d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
ydpiheyvnhelrkrenefsehknvkifvasynlngcsattklenwlfpentpladiyvv
gfqeivqltsadpakrrewescvkrllngkctsgpgyvqlrsgqlvgtalmifckesclp
siknvegtvkktglgnkgavairfdyedtglcfitshlaagytnyderdhdyrtiasglr
frrgrsifnhdyvvwfgdfnyrisltyeevvpciaqgklsylfeydqlnkqmltgkvfpf
fselpitfpptykfdigtdiydtsdkhrvpawtdrilyrgelvphsyqsvplyysdhrpi
yatyeanivkvdrekkkilfeelynqrkqevrdasq

SCOPe Domain Coordinates for d1i9za_:

Click to download the PDB-style file with coordinates for d1i9za_.
(The format of our PDB-style files is described here.)

Timeline for d1i9za_: