Lineage for d1i9ya_ (1i9y A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594378Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2594379Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2594457Family d.151.1.2: Inositol polyphosphate 5-phosphatase (IPP5) [64422] (3 proteins)
  6. 2594463Protein Synaptojanin, IPP5C domain [64423] (1 species)
  7. 2594464Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [64424] (2 PDB entries)
  8. 2594466Domain d1i9ya_: 1i9y A: [62101]

Details for d1i9ya_

PDB Entry: 1i9y (more details), 2 Å

PDB Description: crystal structure of inositol polyphosphate 5-phosphatase domain (ipp5c) of spsynaptojanin
PDB Compounds: (A:) phosphatidylinositol phosphate phosphatase

SCOPe Domain Sequences for d1i9ya_:

Sequence, based on SEQRES records: (download)

>d1i9ya_ d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
ydpiheyvnhelrkrenefsehknvkifvasynlngcsattklenwlfpentpladiyvv
gfqeivqltpqqvisadpakrrewescvkrllngkctsgpgyvqlrsgqlvgtalmifck
esclpsiknvegtvkktglggvsgnkgavairfdyedtglcfitshlaagytnyderdhd
yrtiasglrfrrgrsifnhdyvvwfgdfnyrisltyeevvpciaqgklsylfeydqlnkq
mltgkvfpffselpitfpptykfdigtdiydtsdkhrvpawtdrilyrgelvphsyqsvp
lyysdhrpiyatyeanivkvdrekkkilfeelynqrkqevrdasq

Sequence, based on observed residues (ATOM records): (download)

>d1i9ya_ d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
ydpiheyvnhelrkrenefsehknvkifvasynlngcsattklenwlfpentpladiyvv
gfqeivqltsadpakrrewescvkrllngkctsgpgyvqlrsgqlvgtalmifckesclp
siknvegtvkktglgnkgavairfdyedtglcfitshlaagytnyderdhdyrtiasglr
frrgrsifnhdyvvwfgdfnyrisltyeevvpciaqgklsylfeydqlnkqmltgkvfpf
fselpitfpptykfdigtdiydtsdkhrvpawtdrilyrgelvphsyqsvplyysdhrpi
yatyeanivkvdrekkkilfeelynqrkqevrdasq

SCOPe Domain Coordinates for d1i9ya_:

Click to download the PDB-style file with coordinates for d1i9ya_.
(The format of our PDB-style files is described here.)

Timeline for d1i9ya_: