Lineage for d1i9ya_ (1i9y A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84756Fold d.151: DNase I-like [56218] (1 superfamily)
  4. 84757Superfamily d.151.1: DNase I-like [56219] (2 families) (S)
  5. 84780Family d.151.1.2: Inositol polyphosphate 5-phosphatase (ipp5c) [64422] (1 protein)
  6. 84781Protein Synaptojanin, IPP5C domain [64423] (1 species)
  7. 84782Species Yeast (Schizosaccharomyces pombe) [64424] (2 PDB entries)
  8. 84784Domain d1i9ya_: 1i9y A: [62101]

Details for d1i9ya_

PDB Entry: 1i9y (more details), 2 Å

PDB Description: crystal structure of inositol polyphosphate 5-phosphatase domain (ipp5c) of spsynaptojanin

SCOP Domain Sequences for d1i9ya_:

Sequence, based on SEQRES records: (download)

>d1i9ya_ d.151.1.2 (A:) Synaptojanin, IPP5C domain {Yeast (Schizosaccharomyces pombe)}
ydpiheyvnhelrkrenefsehknvkifvasynlngcsattklenwlfpentpladiyvv
gfqeivqltpqqvisadpakrrewescvkrllngkctsgpgyvqlrsgqlvgtalmifck
esclpsiknvegtvkktglggvsgnkgavairfdyedtglcfitshlaagytnyderdhd
yrtiasglrfrrgrsifnhdyvvwfgdfnyrisltyeevvpciaqgklsylfeydqlnkq
mltgkvfpffselpitfpptykfdigtdiydtsdkhrvpawtdrilyrgelvphsyqsvp
lyysdhrpiyatyeanivkvdrekkkilfeelynqrkqevrdasq

Sequence, based on observed residues (ATOM records): (download)

>d1i9ya_ d.151.1.2 (A:) Synaptojanin, IPP5C domain {Yeast (Schizosaccharomyces pombe)}
ydpiheyvnhelrkrenefsehknvkifvasynlngcsattklenwlfpentpladiyvv
gfqeivqltsadpakrrewescvkrllngkctsgpgyvqlrsgqlvgtalmifckesclp
siknvegtvkktglgnkgavairfdyedtglcfitshlaagytnyderdhdyrtiasglr
frrgrsifnhdyvvwfgdfnyrisltyeevvpciaqgklsylfeydqlnkqmltgkvfpf
fselpitfpptykfdigtdiydtsdkhrvpawtdrilyrgelvphsyqsvplyysdhrpi
yatyeanivkvdrekkkilfeelynqrkqevrdasq

SCOP Domain Coordinates for d1i9ya_:

Click to download the PDB-style file with coordinates for d1i9ya_.
(The format of our PDB-style files is described here.)

Timeline for d1i9ya_: