![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
![]() | Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins) |
![]() | Protein mRNA capping enzyme, triphosphatase domain [64047] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [64048] (2 PDB entries) |
![]() | Domain d1i9ta_: 1i9t A: [62100] complexed with cac, ipa, mg, so4 |
PDB Entry: 1i9t (more details), 1.7 Å
SCOPe Domain Sequences for d1i9ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i9ta_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} kipprwlncprrgqpvagrflplktmlgprydsqvaeenrfhpsmlsnylkslkvkmsll vdltntsrfydrndiekegikyiklqckghgecpttentetfirlcerfnersppeligv hcthgfnrtgflicaflvekmdwsieaavatfaqarppgiykgdylkelfrrygdieeap pppvlpdwcf
Timeline for d1i9ta_: