SCOPe 2.01: Domain d1i9ta_: 1i9t A:

Lineage for d1i9ta_ (1i9t A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)

6. Protein mRNA capping enzyme, triphosphatase domain [64047] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [64048] (2 PDB entries)

8. Domain d1i9ta_: 1i9t A: [62100]
   complexed with cac, ipa, mg, so4

Details for d1i9ta_

PDB Entry: 1i9t, 1.7 Å

PDB Description: crystal structure of the oxidized rna triphosphatase domain of mouse mrna capping enzyme

PDB Compounds: (A:) mRNA capping enzyme

SCOPe Domain Sequences for d1i9ta_:

Sequence; same for both SEQRES and ATOM records:

>d1i9ta_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]}
kipprwlncprrgqpvagrflplktmlgprydsqvaeenrfhpsmlsnylkslkvkmsll
vdltntsrfydrndiekegikyiklqckghgecpttentetfirlcerfnersppeligv
hcthgfnrtgflicaflvekmdwsieaavatfaqarppgiykgdylkelfrrygdieeap
pppvlpdwcf

Timeline for d1i9ta_:

• d1i9ta_ first appeared in SCOP 1.57
  
• d1i9ta_ appears in SCOP 1.75
  
• d1i9ta_ appears in SCOPe 2.02
  
• d1i9ta_ appears in the current release, SCOPe 2.08