Lineage for d1i9ta_ (1i9t A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) 
Family c.45.1.1: Dual specificity phosphatase-like [52800] (5 proteins) Protein mRNA capping enzyme, triphosphatase domain [64047] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [64048] (2 PDB entries) 
Domain d1i9ta_: 1i9t A: [62100]
Details for d1i9ta_
PDB Entry: 1i9t (more details), 1.7 Å
PDB Description: crystal structure of the oxidized rna triphosphatase domain of mouse mrna capping enzyme
SCOP Domain Sequences for d1i9ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i9ta_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus)}
kipprwlncprrgqpvagrflplktmlgprydsqvaeenrfhpsmlsnylkslkvkmsll
vdltntsrfydrndiekegikyiklqckghgecpttentetfirlcerfnersppeligv
hcthgfnrtgflicaflvekmdwsieaavatfaqarppgiykgdylkelfrrygdieeap
pppvlpdwcf
SCOP Domain Coordinates for d1i9ta_:
Click to download the PDB-style file with coordinates for d1i9ta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i9ta_:
- d1i9ta_ is new in SCOP 1.57
- d1i9ta_ appears in SCOP 1.59
- d1i9ta_ appears in the current release, SCOPe 2.08
View in 3D