Lineage for d1i9sa_ (1i9s A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851756Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1851757Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1851758Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)
  6. 1851773Protein mRNA capping enzyme, triphosphatase domain [64047] (1 species)
  7. 1851774Species Mouse (Mus musculus) [TaxId:10090] [64048] (2 PDB entries)
  8. 1851775Domain d1i9sa_: 1i9s A: [62099]
    complexed with cac, ipa, mg, so4

Details for d1i9sa_

PDB Entry: 1i9s (more details), 1.65 Å

PDB Description: crystal structure of the rna triphosphatase domain of mouse mrna capping enzyme
PDB Compounds: (A:) mRNA capping enzyme

SCOPe Domain Sequences for d1i9sa_:

Sequence, based on SEQRES records: (download)

>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]}
kipprwlncprrgqpvagrflplktmlgprydsqvaeenrfhpsmlsnylkslkvkmsll
vdltntsrfydrndiekegikyiklqckghgecpttentetfirlcerfnersppeligv
hcthgfnrtgflicaflvekmdwsieaavatfaqarppgiykgdylkelfrrygdieeap
pppvlpdwcfeded

Sequence, based on observed residues (ATOM records): (download)

>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]}
kipprwlncprrgqpvagrflplktmlgprydsqvaeenrfhpsmlsnylkslkvkmsll
vdltntsrfydrndiekegikyiklqckghgecpttentetfirlcerfpeligvhcthg
fnrtgflicaflvekmdwsieaavatfaqarppgiykgdylkelfrrygdieeappppvl
pdwcfeded

SCOPe Domain Coordinates for d1i9sa_:

Click to download the PDB-style file with coordinates for d1i9sa_.
(The format of our PDB-style files is described here.)

Timeline for d1i9sa_: