Lineage for d1i9sa_ (1i9s A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 244631Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1432
  4. 244632Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 244633Family c.45.1.1: Dual specificity phosphatase-like [52800] (5 proteins)
  6. 244648Protein mRNA capping enzyme, triphosphatase domain [64047] (1 species)
  7. 244649Species Mouse (Mus musculus) [TaxId:10090] [64048] (2 PDB entries)
  8. 244650Domain d1i9sa_: 1i9s A: [62099]
    complexed with cac, ipa, mo6, so4

Details for d1i9sa_

PDB Entry: 1i9s (more details), 1.65 Å

PDB Description: crystal structure of the rna triphosphatase domain of mouse mrna capping enzyme

SCOP Domain Sequences for d1i9sa_:

Sequence, based on SEQRES records: (download)

>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus)}
kipprwlncprrgqpvagrflplktmlgprydsqvaeenrfhpsmlsnylkslkvkmsll
vdltntsrfydrndiekegikyiklqckghgecpttentetfirlcerfnersppeligv
hcthgfnrtgflicaflvekmdwsieaavatfaqarppgiykgdylkelfrrygdieeap
pppvlpdwcfeded

Sequence, based on observed residues (ATOM records): (download)

>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus)}
kipprwlncprrgqpvagrflplktmlgprydsqvaeenrfhpsmlsnylkslkvkmsll
vdltntsrfydrndiekegikyiklqckghgecpttentetfirlcerfpeligvhcthg
fnrtgflicaflvekmdwsieaavatfaqarppgiykgdylkelfrrygdieeappppvl
pdwcfeded

SCOP Domain Coordinates for d1i9sa_:

Click to download the PDB-style file with coordinates for d1i9sa_.
(The format of our PDB-style files is described here.)

Timeline for d1i9sa_: