Lineage for d1i9sa_ (1i9s A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70682Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
  4. 70683Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) (S)
  5. 70684Family c.45.1.1: Dual specificity phosphatase-like [52800] (5 proteins)
  6. 70697Protein mRNA capping enzyme, triphosphatase domain [64047] (1 species)
  7. 70698Species Mouse (Mus musculus) [TaxId:10090] [64048] (2 PDB entries)
  8. 70699Domain d1i9sa_: 1i9s A: [62099]

Details for d1i9sa_

PDB Entry: 1i9s (more details), 1.65 Å

PDB Description: crystal structure of the rna triphosphatase domain of mouse mrna capping enzyme

SCOP Domain Sequences for d1i9sa_:

Sequence, based on SEQRES records: (download)

>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus)}
kipprwlncprrgqpvagrflplktmlgprydsqvaeenrfhpsmlsnylkslkvkmsll
vdltntsrfydrndiekegikyiklqckghgecpttentetfirlcerfnersppeligv
hcthgfnrtgflicaflvekmdwsieaavatfaqarppgiykgdylkelfrrygdieeap
pppvlpdwcfeded

Sequence, based on observed residues (ATOM records): (download)

>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus)}
kipprwlncprrgqpvagrflplktmlgprydsqvaeenrfhpsmlsnylkslkvkmsll
vdltntsrfydrndiekegikyiklqckghgecpttentetfirlcerfpeligvhcthg
fnrtgflicaflvekmdwsieaavatfaqarppgiykgdylkelfrrygdieeappppvl
pdwcfeded

SCOP Domain Coordinates for d1i9sa_:

Click to download the PDB-style file with coordinates for d1i9sa_.
(The format of our PDB-style files is described here.)

Timeline for d1i9sa_: